PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.006G266600.1.p
Common NameSb06g032880, SORBIDRAFT_06g032880
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 303aa    MW: 31247.5 Da    PI: 5.8737
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.006G266600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding285.1e-091866245
                          SSS-HHHHHHHHHHHHHTTTT......-HHHHHHHHTTTS-HHHHHHHHH CS
       Myb_DNA-binding  2 grWTteEdellvdavkqlGgg......tWktIartmgkgRtlkqcksrwq 45
                          g+WT e ++ + +av+   gg      +W++ a+ +  g+t+++++ ++ 
  Sobic.006G266600.1.p 18 GAWTREQEKAFENAVATTMGGeedgdaRWEKLAEAVE-GKTPEEVRRHYE 66
                          79**************999999***************.**********95 PP

2Myb_DNA-binding39.81.1e-12129173347
                           SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
       Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                           +WT++E+ l++ + +++G+g+W++I+r +   Rt+ q+ s+ qky
  Sobic.006G266600.1.p 129 AWTEDEHRLFLLGLEKYGKGDWRSISRNFVISRTPTQVASHAQKY 173
                           6*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512937.4951573IPR017884SANT domain
SMARTSM007174.2E-51671IPR001005SANT/Myb domain
PfamPF002494.7E-61866IPR001005SANT/Myb domain
SuperFamilySSF466891.51E-82075IPR009057Homeodomain-like
CDDcd001679.04E-72069No hitNo description
PROSITE profilePS5129416.605122178IPR017930Myb domain
SuperFamilySSF466892.09E-16124179IPR009057Homeodomain-like
SMARTSM007179.3E-11126176IPR001005SANT/Myb domain
TIGRFAMsTIGR015572.8E-17126176IPR006447Myb domain, plants
CDDcd001673.26E-10129174No hitNo description
PfamPF002493.4E-11129173IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.8E-11129172IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MAVEEASSSG GGGEEGCGAW TREQEKAFEN AVATTMGGEE DGDARWEKLA EAVEGKTPEE  60
VRRHYELLVE DVDGIESGRV PLPTYAADGA AEEGGGGGGG GKKGGGGGGT HGDKGSAKSA  120
EQERRKGIAW TEDEHRLFLL GLEKYGKGDW RSISRNFVIS RTPTQVASHA QKYFIRLNSM  180
NRERRRSSIH DITSVNNGDA STAQGPITGQ TNGQAANPGK PSKQSPQPAN TPPGVDAYGT  240
TIGQPVGGPL VSAVGTPVTL PVSAPPHLAY GMHAPVPGAV VPGAPVNIAP MPYPMPPPSS  300
HG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A3e-1720891177RADIALIS
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
199107GGKKGGGGG
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00500DAPTransfer from AT5G08520Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHF6794430.0HF679443.1 Saccharum hybrid cultivar Co 86032 mRNA for ScMYB37 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002448771.10.0hypothetical protein SORBIDRAFT_06g032880
SwissprotQ8S9H73e-59DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLC5YAI20.0C5YAI2_SORBI; Putative uncharacterized protein Sb06g032880
STRINGSb06g032880.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP63763854
Representative plantOGRP27517122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.11e-87MYB family protein